PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00055391001
Common NameGSBRNA2T00055391001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 402aa    MW: 44544.4 Da    PI: 4.7356
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00055391001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.89.2e-32219273155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav+qLGGse+AtPk++l+l++ + Lt++hvkSHLQkYR+
  GSBRNA2T00055391001 219 KQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPILTIYHVKSHLQKYRT 273
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-29217275IPR009057Homeodomain-like
SuperFamilySSF466893.76E-16217273IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-22219273IPR006447Myb domain, plants
PfamPF002493.4E-9221272IPR001005SANT/Myb domain
PfamPF143795.8E-21307353IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MTMANDFGYS TSFSALHTSV EDRYPNSFYG SSGQELMNNP VPCQVVSGGN SGGYMFPSPS  60
GFCNVSPLST HGRASQTQPP VATTPSDRLA MQDCFLEAQS MNHPLPEFSD PLDEFFDFSD  120
HVPALNPQAE SSDVMVGSTV EVHEKSEWQS WADQLMSVDN GSEPNWSELL GDPSPHNLTP  180
PTPSLDVPRQ EVVANQQQHQ VVSLEEQLNS SASGGATTKQ RMRWTPELHE AFVEAVNQLG  240
GSERATPKAV LKLLNNPILT IYHVKSHLQK YRTARYKPET SEATGEPQEK KMTSIEDIKS  300
LDMKTSVEIT QALRLQMEVQ KRLHEQLETQ RALQLQIEKQ GRYLQMMFEK QQKLEENKSS  360
SSSKQCNASA EVEFESGVVT QAGDLSESAV SVSRKRARED E*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.61140.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00055391001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013663052.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
SwissprotQ8GUN50.0PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078H8R80.0A0A078H8R8_BRANA; BnaA02g30980D protein
STRINGBra020622.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]